TBC1 Domain Family, Member 10C (TBC1D10C) antibody

Antigen: TBC1 Domain Family, Member 10C (TBC1D10C)

Synonyms: CARABIN, FLJ00332, MGC46488, AI428527, 1810062O14Rik, RGD1311490, TBC1D10C, MGC152584

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN503789

Additional Information

Alternative name: Carabin

Gene ID: TBC1D10C

UniProt: Q8IV04

Immunogen: The immunogen for anti-TBC1D10C antibody: synthetic peptide directed towards the N terminal of human TBC1D10C

Sequence: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRY GFIGGSSAEP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TBC1D10C antibody concentration is 1 mg/ml.

Description: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).[supplied by OMIM].

Characteristics: Antigen Size: 446 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-TBC1D10C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TBC1D10C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus

Publications

Product: Pan, Sun, Kardian et al.: "Feedback inhibition of calcineurin and Ras by a dual inhibitory protein Carabin." in: Nature, Vol. 445, Issue 7126, pp. 433-6, 2007 (PubMed).