Adhesion Molecule with Ig Like Domain 3 (AMIGO3) antibody

Antigen: Adhesion Molecule with Ig Like Domain 3 (AMIGO3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503799

Additional Information

Alternative name: AMIGO3 / ALI3

Gene ID: AMIGO3

UniProt: Q86WK7

Immunogen: The immunogen for anti-AMIGO3 antibody: synthetic peptide directed towards the N terminal of human AMIGO3

Sequence: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCIC AADLLSCTGL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-AMIGO3 antibody concentration is 1 mg/ml.

Description: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Characteristics: Antigen Size: 504 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-AMIGO3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-AMIGO3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Publications

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).