AMIGO3 antibody (N-Term)

Catalog No. ABIN635891

Product Details anti-AMIGO3 Antibody

Target: AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMIGO3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AMIGO3 antibody was raised against the N terminal of AMIGO3

Purification: Affinity purified

Immunogen: AMIGO3 antibody was raised using the N terminal of AMIGO3 corresponding to a region with amino acids MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMIGO3 Blocking Peptide, catalog no. 33R-6574, is also available for use as a blocking control in assays to test for specificity of this AMIGO3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMIGO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AMIGO3

Target: AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))

Alternative Name: AMIGO3 (AMIGO3 Products)

Synonyms: E430002N15Rik antibody, ali3 antibody, mKIAA1851 antibody, AMIGO-3 antibody, adhesion molecule with Ig-like domain 3 antibody, adhesion molecule with Ig like domain 3 antibody, amigo3 antibody, Amigo3 antibody, AMIGO3 antibody

Background: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Molecular Weight: 55 kDa (MW of target protein)