Nucleoporin 43kDa (NUP43) (Middle Region) antibody

Details for Product No. ABIN503800
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bA350J20.1, p42, AA409950, 2610016K01Rik, 2610529I12Rik, MGC184722, MGC154553
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(6)
Host
Rabbit
(4), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503800
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NUP43
Sequence HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPC LVCGTDAEAI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against NUP43. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NUP43
Background NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).
Molecular Weight 42 kDa
Gene ID 348995
NCBI Accession NM_198887, NP_942590
UniProt Q8NFH3
Research Area Chromatin and Nuclear Signaling, Transporters
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 380 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nucleoporin 43kDa (NUP43) (Middle Region) antibody WB Suggested Anti-NUP43 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (4), (4)
Reactivities (6)
Applications (7), (3), (1), (1), (1)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top