Zinc Finger, C3HC-Type Containing 13 (ZCCHC13) antibody

Antigen: Zinc Finger, C3HC-Type Containing 13 (ZCCHC13)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503807

Additional Information

Alternative name: ZCCHC13

Gene ID: ZCCHC13

UniProt: Q8WW36

Immunogen: The immunogen for anti-ZCCHC13 antibody: synthetic peptide directed towards the middle region of human ZCCHC13

Sequence: GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLR QIPTSSQGMS

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZCCHC13 antibody concentration is 1 mg/ml.

Description: The specific function of this protein remains unknown.

Characteristics: Antigen Size: 166 amino acids

Molecular Weight: 18kDa

Application Details

Application Notes: WB Suggested Anti-ZCCHC13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human kidney.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin Binding Proteins

Restrictions: For Research Use only

Images

WB Suggested Anti-ZCCHC13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human kidney

Publications

Product: Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).