Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein S21 (RPS21) (N-Term) antibody

Details for Product No. ABIN503876
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms S21, 1810049N11Rik, 2410030A14Rik, zgc:56642, zgc:86816, RPS21, CG2986, Dmel\\CG2986, M(2)23B, l(2)03575, l(2)168/14, l(2)k16814, oho23, oho23B, rpS21
Epitope
N-Term
(3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(15), (7), (7)
Host
Rabbit
(17)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (7), (4), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503876
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RPS21
Sequence MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVD KVTGRFNGQF
Predicted Reactivity Chicken : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against RPS21. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RPS21
Background The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S21E family of ribosomal proteins. It is located in the cytoplasm. Alternative splice variants that encode different protein isoforms have been described, but their existence has not been verified. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 9 kDa
Gene ID 6227
NCBI Accession NM_001024, NP_001015
UniProt P63220
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 83 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein S21 (RPS21) (N-Term) antibody WB Suggested Anti-RPS21 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (17)
Reactivities (15), (7), (7)
Applications (13), (7), (4), (3)
Epitopes (3), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503876
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top