Rhotekin (RTKN) (Middle Region) antibody

Details for Product No. ABIN503878
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RTKN
Epitope
Middle Region
(2), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(13), (3), (3), (1), (1), (1)
Host
Rabbit
(9), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (6), (5), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503878
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RTKN
Sequence IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQ REGARLETPP
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against RTKN. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RTKN
Background RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 63 kDa
Gene ID 6242
NCBI Accession NM_001015055, NP_001015055
UniProt Q9BST9
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 563 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Rhotekin (RTKN) (Middle Region) antibody WB Suggested Anti-RTKN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Sudo, Ito, Iwamoto et al.: "SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling." in: Human mutation, Vol. 28, Issue 10, pp. 1005-13, 2007 (PubMed).

Hosts (9), (6)
Reactivities (13), (3), (3), (1), (1), (1)
Applications (14), (6), (5), (2), (1)
Epitopes (2), (2), (1)
back to top