Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503884

Histone H2B Type 2-F (HIST2H2BF) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503884
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HIST2H2BF antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF
Sequence MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSV YVYKVLKQVH
Predicted Reactivity Human : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against HIST2H2BF. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HIST2H2BF
Background HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Molecular Weight 14kDa
Gene ID 440689
NCBI Accession NP_001019770, NM_001024599
UniProt Q5QNW6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HIST2H2BF antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Sprung, Chen et al.: "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." in: Molecular cell, Vol. 23, Issue 4, pp. 607-18, 2006 (PubMed).

Alternatives for antigen "Histone H2B Type 2-F (HIST2H2BF)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5)
Epitopes (4), (2), (1)
Beacon