Did you know that you can buy products from over 140 different suppliers from us?

Histone H2B Type 2-F (HIST2H2BF) (N-Term) antibody

Details for Product No. ABIN503884
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(7), (7)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(8)
Host
Rabbit
(9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Chromatin Immunoprecipitation (ChIP), Western Blotting (WB)
(9), (6)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503884
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HIST2H2BF
Sequence MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSV YVYKVLKQVH
Predicted Reactivity Human : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against HIST2H2BF. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HIST2H2BF
Background HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Molecular Weight 14 kDa
Gene ID 440689
NCBI Accession NM_001024599, NP_001019770
UniProt Q5QNW6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 126 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Histone H2B Type 2-F (HIST2H2BF) (N-Term) antibody WB Suggested Anti-HIST2H2BF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine
Background publications Kim, Sprung, Chen et al.: "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." in: Molecular cell, Vol. 23, Issue 4, pp. 607-18, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503884
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top