Myotubularin Related Protein 12 (MTMR12) antibody

Antigen: Myotubularin Related Protein 12 (MTMR12)

Synonyms: 3-PAP, PIP3AP, 3Pap, Pip3ap, mKIAA1682, 4932703C11, C730015A02Rik, MGC109012, MTMR12, pip3ap, im:7160376

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503906

Additional Information

Alternative name: MTMR12

Gene ID: MTMR12

UniProt: Q9C0I1

Immunogen: The immunogen for anti-MTMR12 antibody: synthetic peptide directed towards the middle region of human MTMR12

Sequence: RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAK REDEFVDLGD

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MTMR12 antibody concentration is 1 mg/ml.

Description: MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes. The protein encoded by this gene functions as an adaptor subunit in a complex with an active PtdIns(3)P 3-phosphatase. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined.

Characteristics: Antigen Size: 747 amino acids

Molecular Weight: 86kDa

Application Details

Application Notes: WB Suggested Anti-MTMR12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MTMR12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Publications

Product: Nandurkar, Layton, Laporte et al.: "Identification of myotubularin as the lipid phosphatase catalytic subunit associated with the 3-phosphatase adapter protein, 3-PAP." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 100, Issue 15, pp. 8660-5, 2003 (PubMed).