Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503930

Melanoma Antigen Family B, 3 (MAGEB3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CT3.5, Smage3, Mage-b3, Mage-ps1, Mage-rs3, RGD1562343, Mageb3, EG436212, MAGEB3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503930
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAGEB3 antibody: synthetic peptide directed towards the N terminal of human MAGEB3
Sequence MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSF SSPLILGATI
Predicted Reactivity Human :100%,   Crab-eating macaque :78%,   Cat :76%,  
Characteristics This is a rabbit polyclonal antibody against MAGEB3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAGEB3
Background This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos
Molecular Weight 39kDa
Gene ID 4114
NCBI Accession NP_002356, NM_002365
UniProt O15480
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAGEB3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Melanoma Antigen Family B, 3 (MAGEB3)", type "Antibodies"
Hosts (25)
Reactivities (23)
Applications (10), (9), (9), (9), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3)
Beacon