MAGEB3 antibody (N-Term)

Catalog No. ABIN632466

Product Details anti-MAGEB3 Antibody

Target: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEB3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAGEB3 antibody was raised against the N terminal of MAGEB3

Purification: Affinity purified

Immunogen: MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEB3 Blocking Peptide, catalog no. 33R-6303, is also available for use as a blocking control in assays to test for specificity of this MAGEB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEB3

Target: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Alternative Name: MAGEB3 (MAGEB3 Products)

Synonyms: CT3.5 antibody, Smage3 antibody, Mage-b3 antibody, Mage-ps1 antibody, Mage-rs3 antibody, RGD1562343 antibody, MAGEB3 antibody, MAGE family member B3 antibody, melanoma antigen, family B, 3 antibody, melanoma-associated antigen B3 antibody, MAGE family member B5 antibody, MAGEB3 antibody, Mageb3 antibody, LOC509870 antibody, MAGEB5 antibody

Background: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Molecular Weight: 39 kDa (MW of target protein)