Pleckstrin (PLEK) (N-Term) antibody

Details for Product No. ABIN503953
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms P47, 2010300B13Rik, MGC69065, PLEK
Epitope
N-Term
(4), (3), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(55), (14), (12), (12), (2)
Host
Rabbit
(27), (22), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(45), (19), (18), (14), (10), (9), (4), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN503953
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PLEK
Sequence MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKS DNSPKGMIPL
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %, Chicken : 90 %, Dog : 90 %, Horse : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against PLEK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PLEK
Background PLEK is a major protein kinase C substrate of platelets, its exact function is not known.
Molecular Weight 40 kDa
Gene ID 5341
NCBI Accession NM_002664, NP_002655
UniProt P08567
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 350 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pleckstrin (PLEK) (N-Term) antibody WB Suggested Anti-PLEK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (27), (22), (8)
Reactivities (55), (14), (12), (12), (2)
Applications (45), (19), (18), (14), (10), (9), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (1), (1), (1)
back to top