Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503953

Pleckstrin (PLEK) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P47, 2010300B13Rik, MGC69065, PLEK
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503953
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PLEK antibody: synthetic peptide directed towards the N terminal of human PLEK
Sequence MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKS DNSPKGMIPL
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 100%, Chicken : 92%, Dog : 92%, Horse : 92%, African clawed frog : 83%
Characteristics This is a rabbit polyclonal antibody against PLEK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PLEK
Background PLEK is a major protein kinase C substrate of platelets, its exact function is not known.
Molecular Weight 40kDa
Gene ID 5341
NCBI Accession NP_002655, NM_002664
UniProt P08567
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PLEK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Pleckstrin (PLEK)", type "Antibodies"
Hosts (26), (20), (9)
Reactivities (53), (14), (12), (12), (2)
Applications (45), (21), (19), (14), (10), (9), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1)
Beacon