Did you know that you can buy products from over 140 different suppliers from us?

Mitogen-Activated Protein Kinase 4 (MAPK4) (Middle Region) antibody

Details for Product No. ABIN503967
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ERK-4, ERK3, Erk4, MAPK 4, PRKM4, p63MAPK, A330097D03Rik, Erk3, Prkm4, p63Mapk, erk4, wu:fi27d11, zgc:55498, ATMPK4, F2N1.1, F2N1_1, MAP kinase 4
Epitope
Middle Region
(21), (11), (7), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
(43), (20), (12)
Host
Rabbit
(43), (5), (2), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(39), (20), (16), (12), (10), (6), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503967
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MAPK4
Sequence DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQH PFRIEDEIDD
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Rabbit : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against MAPK4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MAPK4
Background Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe
Molecular Weight 66 kDa
Gene ID 5596
NCBI Accession NM_002747, NP_002738
UniProt P31152
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 587 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitogen-Activated Protein Kinase 4 (MAPK4) (Middle Region) antibody WB Suggested Anti-MAPK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart
Background publications Lerner-Marmarosh, Miralem, Gibbs et al.: "Human biliverdin reductase is an ERK activator; hBVR is an ERK nuclear transporter and is required for MAPK signaling." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 19, pp. 6870-5, 2008 (PubMed).

Validation Images
back to top