Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503967

Mitogen-Activated Protein Kinase 4 (MAPK4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ERK-4, ERK3, Erk4, MAPK 4, PRKM4, p63MAPK, erk4, zgc:55498, wu:fi27d11
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503967
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAPK4 antibody: synthetic peptide directed towards the middle region of human MAPK4
Sequence DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQH PFRIEDEIDD
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Rabbit : 92%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against MAPK4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAPK4
Background Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe
Molecular Weight 66kDa
Gene ID 5596
NCBI Accession NP_002738, NM_002747
UniProt P31152
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAPK4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lerner-Marmarosh, Miralem, Gibbs et al.: "Human biliverdin reductase is an ERK activator; hBVR is an ERK nuclear transporter and is required for MAPK signaling." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 19, pp. 6870-5, 2008 (PubMed).

Alternatives for antigen "Mitogen-Activated Protein Kinase 4 (MAPK4)", type "Antibodies"
Hosts (30), (4), (2), (1), (1)
Reactivities (36), (13), (8)
Applications (28), (11), (11), (7), (6), (6), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (8), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon