Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Mitogen-Activated Protein Kinase 4 (MAPK4) antibody

Antigen

Mitogen-Activated Protein Kinase 4 (MAPK4)

Synonyms ERK3, Erk4, PRKM4, p63MAPK, Erk3, Prkm4, p63Mapk, A330097D03Rik, erk4, zgc:55498, wu:fi27d11
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503967
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MAPK4 / ERK4
Gene ID MAPK4
UniProt P31152
Immunogen The immunogen for anti-MAPK4 antibody: synthetic peptide directed towards the middle region of human MAPK4
Sequence DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQH PFRIEDEIDD
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MAPK4 antibody concentration is 1 mg/ml.
Description Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe
Characteristics Antigen Size: 587 amino acids
Molecular Weight 66kDa

Application Details

Application Notes WB Suggested Anti-MAPK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Lerner-Marmarosh, Miralem, Gibbs et al.: "Human biliverdin reductase is an ERK activator; hBVR is an ERK nuclear transporter and is required for MAPK signaling." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 19, pp. 6870-5, 2008 (PubMed).

Alternatives

Alternatives for antigen "Mitogen-Activated Protein Kinase 4 (MAPK4)", type "Antibodies"
Hosts Rabbit (32), Sheep (2), Mouse (1), Rat (1)
Reactivities Human (32), Mouse (Murine) (21), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (18), Western Blotting (WB) (18), ELISA (13), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunohistochemistry (IHC) (4), Immunocytochemistry (ICC) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (24), N-Term (4), AA 1-286 (1), Internal Region (1), N-Term,AA 66-94 (1)