Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504015

Phosphoserine Phosphatase (PSPH) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PSP, PSPHD, PSPase, AI480570, PSPH, psph, MGC78828, zgc:112414, DDBDRAFT_0183847, DDBDRAFT_0230054, DDB_0183847, DDB_0230054, DKFZp469L1337
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504015
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH
Sequence IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYIT DFVELLGELE
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Sheep : 100%, African clawed frog : 78%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against PSPH. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PSPH
Background The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved i
Molecular Weight 25kDa
Gene ID 5723
NCBI Accession NP_004568, NM_004577
UniProt P78330
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSPH antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Phosphoserine Phosphatase (PSPH)", type "Antibodies"
Hosts (20), (12), (6)
Reactivities (37), (10), (4)
Applications (35), (25), (4), (2), (1)
Epitopes (10), (4), (3), (2), (2), (1), (1), (1)
Beacon