Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504022

NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NDPK-D, NM23H4, nm23-H4, 2610027N22Rik, 2810024O08Rik, 5730493H09Rik, NM23-M4, Nm23M4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504022
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NME4 antibody: synthetic peptide directed towards the middle region of human NME4
Sequence VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHIS RNVIHASDSV
Predicted Reactivity Human : 100%, Horse : 92%, Mouse : 92%, Pig : 92%, Rat : 92%, Bovine : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against NME4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NME4
Background The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm2
Molecular Weight 21kDa
Gene ID 4833
NCBI Accession NP_005000, NM_005009
UniProt O00746
Research Area Neurology, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NME4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Alternatives for antigen "NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4)", type "Antibodies"
Hosts (26), (10)
Reactivities (32), (15), (12), (12), (12)
Applications (26), (14), (10), (10), (9), (8), (4), (3), (3), (1)
Conjugates (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (2), (1), (1), (1)
Beacon