Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2) antibody

Antigen

serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2)
Synonyms MEPI, PI14, PANCPIN, TSA2004, Spi14, 1810006A24Rik, MGC157389
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504049
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name SERPINI2
Gene ID SERPINI2
UniProt O75830
Immunogen The immunogen for anti-SERPINI2 antibody: synthetic peptide directed towards the middle region of human SERPINI2
Sequence LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEV YVSQVTQKVF
Cross-Reactivity Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SERPINI2 antibody concentration is 1 mg/ml.
Description The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation, fibrinolysis, developmen
Characteristics Antigen Size: 405 amino acids
Molecular Weight 46kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-SERPINI2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2)", type "Antibodies"
Hosts Rabbit (28), Goat (4), Sheep (4)
Reactivities Human (29), Mouse (Murine) (25), Rat (Rattus) (21), Dog (Canine) (19)
Applications Western Blotting (WB) (20), ELISA (15), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Biotin (3), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (3), Center (1)