Did you know that you can buy products from over 140 different suppliers from us?

Phosphoglucomutase 3 (PGM3) (Middle Region) antibody

Details for Product No. ABIN504073
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AGM1, PAGM, PGM 3, Agm1, Pgm-3, C77933, BB187688, 2810473H05Rik, pgm3, MGC69105, wu:fc08c11, wu:fc39c03, zgc:91932, PGM3
Epitope
Middle Region
(7), (7), (6), (4), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(38), (2), (1), (1)
Host
Rabbit
(23), (17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(37), (20), (12), (5), (5), (3), (3), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504073
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PGM3
Sequence GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQE FDIGVYFEAN
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PGM3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PGM3
Background PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.
Molecular Weight 60 kDa
Gene ID 5238
NCBI Accession NM_015599, NP_056414
UniProt O95394
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 542 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Phosphoglucomutase 3 (PGM3) (Middle Region) antibody WB Suggested Anti-PGM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504073
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top