Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504073

Phosphoglucomutase 3 (PGM3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AGM1, PAGM, PGM 3, Agm1, Pgm-3, C77933, BB187688, 2810473H05Rik, pgm3, MGC69105, wu:fc08c11, wu:fc39c03, zgc:91932, PGM3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504073
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PGM3 antibody: synthetic peptide directed towards the middle region of human PGM3
Sequence GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQE FDIGVYFEAN
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against PGM3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PGM3
Background PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.
Molecular Weight 60kDa
Gene ID 5238
NCBI Accession NP_056414, NM_015599
UniProt O95394
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PGM3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Phosphoglucomutase 3 (PGM3)", type "Antibodies"
Hosts (14), (10)
Reactivities (22), (3), (1), (1)
Applications (23), (8), (6), (5), (5), (2), (2), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1), (1)
Beacon