Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Family with Sequence Similarity 135, Member B (FAM135B) antibody

Antigen

Family with Sequence Similarity 135, Member B (FAM135B)

Synonyms C8ORFK32, MGC33221, MGC126009, MGC126010, MGC159348, MGC159350, 1700010C24Rik, A830008O07Rik, MGC81353
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504081
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name FAM135B
Gene ID FAM135B
UniProt Q49AJ0
Immunogen The immunogen for anti-FAM135B antibody: synthetic peptide directed towards the middle region of human FAM135B
Sequence TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQ KTGLQYFKNV
Cross-Reactivity Human, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-FAM135B antibody concentration is 1 mg/ml.
Description The function of this protein remains unknown.
Characteristics Antigen Size: 1406 amino acids
Molecular Weight 156kDa

Application Details

Application Notes WB Suggested Anti-FAM135B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives

Alternatives for antigen "Family with Sequence Similarity 135, Member B (FAM135B)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Internal Region (1)