Did you know that you can buy products from over 140 different suppliers from us?

RAB23, Member RAS Oncogene Family (RAB23) (N-Term) antibody

Details for Product No. ABIN504110
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC137, opb, opb2, AW545388, Rab23-like, MGC82152, hspc137, zgc:110261
Epitope
N-Term
(5), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(36), (22), (16), (13), (12), (12)
Host
Rabbit
(26), (10), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(29), (18), (10), (5), (5), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504110
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RAB23
Sequence TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAI TKAYYRGAQA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, African clawed frog : 90 %, Chicken : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against RAB23. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RAB23
Background The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript va
Molecular Weight 27 kDa
Gene ID 51715
NCBI Accession NM_016104, NP_057361
UniProt Q9ULC3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 237 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RAB23, Member RAS Oncogene Family (RAB23) (N-Term) antibody WB Suggested Anti-RAB23 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504110
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top