Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504110

RAB23, Member RAS Oncogene Family (RAB23) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC137, opb, opb2, AW545388, Rab23-like, MGC82152, hspc137, zgc:110261
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504110
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAB23 antibody: synthetic peptide directed towards the N terminal of human RAB23
Sequence TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAI TKAYYRGAQA
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, African clawed frog : 92%, Chicken : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against RAB23. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RAB23
Background The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript va
Molecular Weight 27kDa
Gene ID 51715
NCBI Accession NP_057361, NM_016104
UniProt Q9ULC3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAB23 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "RAB23, Member RAS Oncogene Family (RAB23)", type "Antibodies"
Hosts (22), (6), (6)
Reactivities (29), (23), (15), (13), (12), (12)
Applications (24), (12), (10), (5), (5), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (1), (1), (1)
Beacon