Proline Rich 16 (PRR16) (Middle Region) antibody

Details for Product No. ABIN504132
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms DSC54, 5430406M13Rik, AI607429, RGD1564528
Epitope
Middle Region
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(6), (2)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN504132
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PRR16
Sequence RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPP GKIPHQGPPL
Predicted Reactivity Chicken : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Horse : 90 %, Bovine : 80 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against PRR16. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PRR16
Background The function of this protein remains unknown.
Molecular Weight 30 kDa
Gene ID 51334
NCBI Accession NM_016644, NP_057728
UniProt Q569H4-3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 281 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proline Rich 16 (PRR16) (Middle Region) antibody WB Suggested Anti-PRR16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine
Product cited in: Barberi, Willis, Socci et al.: "Derivation of multipotent mesenchymal precursors from human embryonic stem cells." in: PLoS medicine, Vol. 2, Issue 6, pp. e161, 2005 (PubMed).

Hosts (7), (1)
Reactivities (6), (2)
Applications (8), (2), (2)
Epitopes (2), (2), (1), (1), (1)
back to top