Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504132

Proline Rich 16 (PRR16) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DSC54, 5430406M13Rik, AI607429, RGD1564528
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504132
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRR16 antibody: synthetic peptide directed towards the middle region of human PRR16
Sequence RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPP GKIPHQGPPL
Predicted Reactivity Chicken : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Horse : 92%, Bovine : 85%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against PRR16. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRR16
Background The function of this protein remains unknown.
Molecular Weight 30kDa
Gene ID 51334
NCBI Accession NP_057728, NM_016644
UniProt Q569H4-3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRR16 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Barberi, Willis, Socci et al.: "Derivation of multipotent mesenchymal precursors from human embryonic stem cells." in: PLoS medicine, Vol. 2, Issue 6, pp. e161, 2005 (PubMed).

Alternatives for antigen "Proline Rich 16 (PRR16)", type "Antibodies"
Hosts (9), (1)
Reactivities (8), (2)
Applications (10), (3), (3), (2)
Epitopes (4), (2), (2), (2), (1), (1)
Beacon