WD Repeat Domain 55 (WDR55) (Middle Region) antibody

Details for Product No. ABIN504152
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C80692, 2410080P20Rik, LRRG00133, RGD1305640, flj20195l, zgc:111796, MGC146726
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 2 references available
Catalog no. ABIN504152
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human WDR55
Sequence AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTL MKWGKKVACG
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against WDR55. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WDR55
Background WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.
Molecular Weight 42 kDa
Gene ID 54853
NCBI Accession NM_017706, NP_060176
UniProt Q9H6Y2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 383 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-WD Repeat Domain 55 (WDR55) (Middle Region) antibody WB Suggested Anti-WDR55 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (2), (1)
Reactivities (2)
Applications (3), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top