O-Sialoglycoprotein Endopeptidase (OSGEP) (Middle Region) antibody

Details for Product No. ABIN504159
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms GCPL1, KAE1, OSGEP1, PRSMG1, GCPL-1, 1500019L24Rik, MGC64557, wu:fj38e02, zgc:112527, si:ch211-214j24.11, Afu6g04510, Tb07.33N13.430
Epitope
Middle Region
(2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(15), (5), (5), (1)
Host
Rabbit
(12), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(17), (7), (4), (4), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504159
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human OSGEP
Sequence EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQ MAKRGKKLVE
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Dog : 100 %, Goat : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against OSGEP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name OSGEP
Background O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.
Molecular Weight 36 kDa
Gene ID 55644
NCBI Accession NM_017807, NP_060277
UniProt Q9NPF4
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 335 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-O-Sialoglycoprotein Endopeptidase (OSGEP) (Middle Region) antibody WB Suggested Anti-OSGEP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (12), (5)
Reactivities (15), (5), (5), (1)
Applications (17), (7), (4), (4), (3), (2), (1)
Epitopes (2), (1), (1), (1), (1)
back to top