Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504159

O-Sialoglycoprotein Endopeptidase (OSGEP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GCPL1, KAE1, OSGEP1, PRSMG1, GCPL-1, 1500019L24Rik, MGC64557, wu:fj38e02, zgc:112527, si:ch211-214j24.11, Afu6g04510, Tb07.33N13.430
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504159
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OSGEP antibody: synthetic peptide directed towards the middle region of human OSGEP
Sequence EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQ MAKRGKKLVE
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Dog : 100%, Goat : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against OSGEP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OSGEP
Background O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.
Molecular Weight 36kDa
Gene ID 55644
NCBI Accession NP_060277, NM_017807
UniProt Q9NPF4
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OSGEP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "O-Sialoglycoprotein Endopeptidase (OSGEP)", type "Antibodies"
Hosts (10), (5)
Reactivities (13), (5), (5), (1)
Applications (15), (5), (5), (4), (3), (2), (1)
Epitopes (3), (2), (1), (1)
Beacon