Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504164

Required For Meiotic Nuclear Division 1 Homolog (S. Cerevisiae) (RMND1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf96, COXPD11, RMD1, bA351K16, bA351K16.3, AA408137, AI462664, AW536662, 0610042C05Rik, Iag-1, RGD1309546, zgc:113022, DKFZp469I1433
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504164
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RMND1 antibody: synthetic peptide directed towards the middle region of human RMND1
Sequence LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLN SELDLDDAIL
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Horse : 92%, Rabbit : 92%, Chicken : 85%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against RMND1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RMND1
Background The function of this protein remains unknown.
Molecular Weight 51kDa
Gene ID 55005
NCBI Accession NP_060379, NM_017909
UniProt Q9NWS8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RMND1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Required For Meiotic Nuclear Division 1 Homolog (S. Cerevisiae) (RMND1)", type "Antibodies"
Hosts (13)
Reactivities (12), (11), (11), (11), (11), (11)
Applications (9), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon