Required For Meiotic Nuclear Division 1 Homolog (S. Cerevisiae) (RMND1) (Middle Region) antibody

Details for Product No. ABIN504164
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf96, COXPD11, RMD1, bA351K16, bA351K16.3, AA408137, AI462664, AW536662, 0610042C05Rik, Iag-1, RGD1309546, zgc:113022, DKFZp469I1433
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(13), (11), (11), (11), (11), (11)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (5), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504164
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RMND1
Sequence LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLN SELDLDDAIL
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Horse : 90 %, Rabbit : 90 %, Chicken : 80 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against RMND1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RMND1
Background The function of this protein remains unknown.
Molecular Weight 51 kDa
Gene ID 55005
NCBI Accession NM_017909, NP_060379
UniProt Q9NWS8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 449 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Required For Meiotic Nuclear Division 1 Homolog (S. Cerevisiae) (RMND1) (Middle Region) antibody WB Suggested Anti-RMND1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6...." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Hosts (13), (1)
Reactivities (13), (11), (11), (11), (11), (11)
Applications (9), (5), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top