Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1) antibody

Antigen

N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1)

Synonyms MGC82286, asah1, MGC173782, zgc:101637, ASAH1, MGC140781, DKFZp469G2224, AC, PHP, ASAH, PHP32, FLJ21558, FLJ22079, Asah, AL022942, AU044555, 2310081N20Rik
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504350
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Acid ceramidase
Gene ID ASAH1
UniProt Q13510
Immunogen The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the N terminal of human ASAH1
Sequence MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSG PTYRGAVPWY
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ASAH1 antibody concentration is 1 mg/ml.
Description This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into
Characteristics Antigen Size: 395 amino acids
Molecular Weight 14kDa

Application Details

Application Notes WB Suggested Anti-ASAH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Kim, Satta: "Population genetic analysis of the N-acylsphingosine amidohydrolase gene associated with mental activity in humans." in: Genetics, Vol. 178, Issue 3, pp. 1505-15, 2008 (PubMed).

Alternatives

Alternatives for antigen "N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1)", type "Antibodies"
Hosts Rabbit (16), Mouse (4)
Reactivities Human (16), Mouse (Murine) (5), Rat (Rattus) (5), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Fruit Fly (Drosophila melanogaster) (1)
Applications Western Blotting (WB) (20), ELISA (14), Immunohistochemistry (IHC) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (4), N-Term (2), Internal Region (1)