Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504365

ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Apg4b, APG4B, Aut2b2, apg4b, AUTL1, Autl1, Atg4bl, AW048066, 2510009N07Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504365
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ATG4B antibody: synthetic peptide directed towards the N terminal of human ATG4B
Sequence WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSV LNAFIDRKDS
Predicted Reactivity Guinea pig : 100%, Human : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Mouse : 92%, Pig : 84%, Rabbit : 84%, Chicken : 83%
Characteristics This is a rabbit polyclonal antibody against ATG4B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ATG4B
Background Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4B is a member of the autophagin protein family, it is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 44kDa
Gene ID 23192
NCBI Accession NP_037457, NM_013325
UniProt Q9Y4P1
Research Area Cancer, Autophagy, Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ATG4B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B)", type "Antibodies"
Hosts (68), (3), (2)
Reactivities (73), (31), (20), (17), (14), (14), (5), (4), (2), (1), (1), (1)
Applications (52), (20), (19), (19), (17), (3), (2), (2)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (12), (8), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Beacon