Mitochondrial Ribosomal Protein S15 (MRPS15) antibody

Antigen: Mitochondrial Ribosomal Protein S15 (MRPS15)

Synonyms: DC37, S15mt, RPMS15, MPR-S15, FLJ11564, CG4207, DmelCG4207, DmMRPS15, MRP-S15, mRpS15, Mprs15, 1500003E24Rik, 2410002B11Rik, MGC95073, mrps15

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504371

Additional Information

Alternative name: MRPS15

Gene ID: MRPS15

UniProt: P82914

Immunogen: The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the middle region of human MRPS15

Sequence: QFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKD KAHKRYLLMS

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MRPS15 antibody concentration is 1 mg/ml.

Description: MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family. The protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the protein is the least conserved among small subunit ribosomal proteins.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.

Characteristics: Antigen Size: 257 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Publications

Product: Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).