Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Mitochondrial Ribosomal Protein S15 (MRPS15) antibody

Antigen

Mitochondrial Ribosomal Protein S15 (MRPS15)

Synonyms DC37, S15mt, RPMS15, MPR-S15, FLJ11564, CG4207, DmelCG4207, DmMRPS15, MRP-S15, mRpS15, Mprs15, 1500003E24Rik, 2410002B11Rik, MGC95073, mrps15
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504371
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MRPS15
Gene ID MRPS15
UniProt P82914
Immunogen The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the middle region of human MRPS15
Sequence QFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKD KAHKRYLLMS
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MRPS15 antibody concentration is 1 mg/ml.
Description MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family. The protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the protein is the least conserved among small subunit ribosomal proteins.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Characteristics Antigen Size: 257 amino acids
Molecular Weight 30kDa

Application Details

Application Notes WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only

Publications

Product Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Alternatives

Alternatives for antigen "Mitochondrial Ribosomal Protein S15 (MRPS15)", type "Antibodies"
Hosts Rabbit (13)
Reactivities Human (13), Mouse (Murine) (5), Rat (Rattus) (4), Cow (Bovine) (2), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Western Blotting (WB) (13), ELISA (9), Immunohistochemistry (IHC) (7), Immunofluorescence (IF) (4), Immunoprecipitation (IP) (1)
Epitopes N-Term (2), C-Term (1), Center (1), Internal Region (1)