Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 134 (ZNF134) (Middle Region) antibody

Details for Product No. ABIN504416
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms pHZ-15, ZNF134
Epitope
Middle Region
(9), (7), (5), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(28)
Host
Rabbit
(25), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (16), (4), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504416
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF134
Sequence TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGK AFSRKDTLVQ
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF134. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF134
Background ZNF134 is a candidate transcription factor.
Molecular Weight 48 kDa
Gene ID 7693
NCBI Accession NM_003435, NP_003426
UniProt P52741
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 427 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 134 (ZNF134) (Middle Region) antibody WB Suggested Anti-ZNF134 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Tommerup, Vissing: "Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders." in: Genomics, Vol. 27, Issue 2, pp. 259-64, 1995 (PubMed).

Validation Images
back to top