Zinc Finger Protein 764 (ZNF764) (N-Term) antibody

Details for Product No. ABIN504423
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Zfp764
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Human
(8)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (1), (1), (1)
Pubmed 2 references available
Catalog no. ABIN504423
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF764
Sequence APPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWG CLRPAQRALY
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF764. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF764
Background ZNF764 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF764 may be involved in transcriptional regulation.
Molecular Weight 45 kDa
Gene ID 92595
NCBI Accession NM_033410, NP_219363
UniProt Q96H86
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 408 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 764 (ZNF764) (N-Term) antibody WB Suggested Anti-ZNF764 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (8), (1)
Reactivities (8)
Applications (8), (1), (1), (1)
Epitopes (2), (1), (1), (1)
back to top