Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody

Details for Product No. ABIN504477
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms GPx-4, GSHPx-4, MCSP, PHGPx, snGPx, snPHGPx, Phgpx, gpx-4, snGpx, 1700027O09Rik, mtPHGPx, GP-GPx4, cb563, cb691, PHGPxa, sb:cb563, zgc:92253, wu:fb82e03
Epitope
Middle Region
(10), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(46), (27), (23), (14), (14), (2)
Host
Rabbit
(31), (14), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(32), (30), (14), (12), (10), (7), (3), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504477
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GPX4
Sequence QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPG SNEEIKEFAA
Predicted Reactivity Human : 100 %, Bovine : 80 %, Goat : 80 %, Guinea pig : 80 %, Mouse : 80 %, Rat : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against GPX4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GPX4
Background Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
Molecular Weight 22 kDa
Gene ID 2879
NCBI Accession NM_002085, NP_002076
UniProt P36969
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 197 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody anti-Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody
anti-Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody (2) anti-Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody (Image 2)
anti-Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody (3) anti-Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody (Image 3)
Background publications Peters, Chatterjee, Hayes et al.: "Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 5, pp. 1144-54, 2008 (PubMed).

Hosts (31), (14), (7)
Reactivities (46), (27), (23), (14), (14), (2)
Applications (32), (30), (14), (12), (10), (7), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (3), (2), (2), (1), (1), (1)
back to top