Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504477

Glutathione Peroxidase 4 (GPX4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GPx-4, GSHPx-4, MCSP, PHGPx, snGPx, snPHGPx, Phgpx, gpx-4, snGpx, 1700027O09Rik, mtPHGPx, GP-GPx4, cb563, cb691, PHGPxa, sb:cb563, zgc:92253, wu:fb82e03
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN504477
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4
Sequence QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPG SNEEIKEFAA
Predicted Reactivity Human : 100%, Bovine : 85%, Goat : 85%, Guinea pig : 85%, Mouse : 85%, Rat : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against GPX4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GPX4
Background Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
Molecular Weight 22kDa
Gene ID 2879
NCBI Accession NP_002076, NM_002085
UniProt P36969
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GPX4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Peters, Chatterjee, Hayes et al.: "Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 5, pp. 1144-54, 2008 (PubMed).

Alternatives for antigen "Glutathione Peroxidase 4 (GPX4)", type "Antibodies"
Hosts (30), (17), (8)
Reactivities (50), (27), (24), (14), (14), (2)
Applications (34), (29), (16), (13), (10), (6), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (3), (2), (1), (1), (1)
Beacon