Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504483

Penta-EF-Hand Domain Containing 1 (PEF1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2600002E23Rik, Peflin, zgc:100787, ABP32, PEF1A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504483
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PEF1 antibody: synthetic peptide directed towards the middle region of human PEF1
Sequence WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSP QFTQLLVSRY
Predicted Reactivity African clawed frog : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Bovine : 92%, Guinea pig : 92%, Rabbit : 92%, Rat : 92%, Zebrafish : 90%
Characteristics This is a rabbit polyclonal antibody against PEF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PEF1
Background PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1, MIM 114170), sorcin (SRI, MIM 182520), grancalcin (GCA, MIM 607030), and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1, MIM 114170), sorcin (SRI, MIM 182520), grancalcin (GCA, MIM 607030), and ALG2 (PDCD6, MIM 601057) (Kitaura et al., 2001 [PubMed 11278427]).
Molecular Weight 31kDa
Gene ID 553115
NCBI Accession NP_036524, NM_012392
UniProt Q9UBV8
Research Area Signaling, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PEF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).

Alternatives for antigen "Penta-EF-Hand Domain Containing 1 (PEF1)", type "Antibodies"
Hosts (21), (2)
Reactivities (22), (13), (13), (11), (11)
Applications (14), (9), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1)
Beacon