Penta-EF-Hand Domain Containing 1 (PEF1) (Middle Region) antibody

Details for Product No. ABIN504483
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2600002E23Rik, Peflin, zgc:100787, ABP32, PEF1A
Epitope
Middle Region
(2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human
(22), (13), (13), (11), (11)
Host
Rabbit
(21), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (9), (4), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504483
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PEF1
Sequence WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSP QFTQLLVSRY
Predicted Reactivity African clawed frog : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Bovine : 90 %, Guinea pig : 90 %, Rabbit : 90 %, Rat : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PEF1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PEF1
Background PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1, MIM 114170), sorcin (SRI, MIM 182520), grancalcin (GCA, MIM 607030), and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1, MIM 114170), sorcin (SRI, MIM 182520), grancalcin (GCA, MIM 607030), and ALG2 (PDCD6, MIM 601057) (Kitaura et al., 2001 [PubMed 11278427]).
Molecular Weight 31 kDa
Gene ID 553115
NCBI Accession NM_012392, NP_036524
UniProt Q9UBV8
Research Area Signaling, Apoptosis/Necrosis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 284 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Penta-EF-Hand Domain Containing 1 (PEF1) (Middle Region) antibody WB Suggested Anti-PEF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Background publications Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).

Hosts (21), (2)
Reactivities (22), (13), (13), (11), (11)
Applications (14), (9), (4), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1), (1)
back to top