Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504487

RAN Binding Protein 3 (RANBP3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AA408221, 2610024N24Rik, ranbp3, MGC79798
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504487
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RANBP3 antibody: synthetic peptide directed towards the N terminal of human RANBP3
Sequence MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEE PRGEAEAPHH
Predicted Reactivity Human : 100%, Guinea pig : 92%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against RANBP3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RANBP3
Background RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 62kDa
Gene ID 8498
NCBI Accession NP_015561, NM_007322
UniProt Q9H6Z4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RANBP3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yoon, Shin, Liu et al.: "Ran-binding protein 3 phosphorylation links the Ras and PI3-kinase pathways to nucleocytoplasmic transport." in: Molecular cell, Vol. 29, Issue 3, pp. 362-75, 2008 (PubMed).

Alternatives for antigen "RAN Binding Protein 3 (RANBP3)", type "Antibodies"
Hosts (32), (3)
Reactivities (33), (20), (19), (18), (17), (17), (1)
Applications (19), (15), (10), (9), (6), (5), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (2), (2), (1), (1), (1), (1)
Beacon