Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cyclin E2 (CCNE2) antibody

Antigen

Cyclin E2 (CCNE2)

Synonyms CYCE2, ccne2, MGC53684, MGC132360, cb165, sb:cb165, zgc:86724, CCNE2, cyce2
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504597
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Cyclin E2
Gene ID CCNE2
UniProt O96020
Immunogen The immunogen for anti-CCNE2 antibody: synthetic peptide directed towards the N terminal of human CCNE2
Sequence TTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIET PHKEIGTSDF
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CCNE2 antibody concentration is 1 mg/ml.
Description The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
Characteristics Antigen Size: 404 amino acids
Molecular Weight 47kDa

Application Details

Application Notes WB Suggested Anti-CCNE2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer, Cell Cycle
Restrictions For Research Use only

Publications

Product Li, Santockyte, Shen et al.: "A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers." in: Archives of biochemistry and biophysics, Vol. 453, Issue 1, pp. 70-4, 2006 (PubMed).

Alternatives

Alternatives for antigen "Cyclin E2 (CCNE2)", type "Antibodies"
Hosts Rabbit (47), Mouse (2)
Reactivities Human (46), Mouse (Murine) (28), Rat (Rattus) (24), Cow (Bovine) (19), Horse (Equine) (18), Pig (Porcine) (18), Cat (Feline) (1), Chicken (1), Dog (Canine) (1), Rabbit (1)
Applications Western Blotting (WB) (32), Immunofluorescence (IF) (21), ELISA (18), Immunohistochemistry (IHC) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunoprecipitation (IP) (5), Immunocytochemistry (ICC) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (DB) (1), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (6), N-Term (4), AA 2-15 (3), N-Term,AA 14-43 (1), pThr392 (1)