Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504623

N-Ethylmaleimide Sensitive Fusion Protein Attachment Protein beta (NAPB) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Brp14, E161, I47, SNARE, b-SNAP, Snapb, SNAP-beta
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504623
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NAPB antibody: synthetic peptide directed towards the N terminal of human NAPB
Sequence MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEE ACEMYTRAAN
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against NAPB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NAPB
Background NAPB is required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
Molecular Weight 33kDa
Gene ID 63908
NCBI Accession NP_071363, NM_022080
UniProt Q9H115
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NAPB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "N-Ethylmaleimide Sensitive Fusion Protein Attachment Protein beta (NAPB)", type "Antibodies"
Hosts (7)
Reactivities (7), (2), (2)
Applications (7), (2), (2), (2)
Epitopes (4), (2), (1)
Beacon