SRY antibody (Middle Region)

Catalog No. ABIN5518959

Product Details anti-SRY Antibody

Target: SRY (Sex Determining Region Y (SRY))

Binding Specificity: AA 90-130, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRY antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Sex-determining region Y protein(SRY) detection. Tested with WB in Human.

Sequence: ISKQLGYQWK MLTEAEKWPF FQEAQKLQAM HREKYPNYKY R

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Sex-determining region Y protein(SRY) detection. Tested with WB in Human.
Gene Name: sex determining region Y
Protein Name: Sex-determining region Y protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for SRY

Target: SRY (Sex Determining Region Y (SRY))

Alternative Name: SRY (SRY Products)

Synonyms: SRXX1 antibody, SRXY1 antibody, TDF antibody, TDY antibody, SRYGENE antibody, Sry1 antibody, Sry3BI antibody, Tdf antibody, Tdy antibody, SRY antibody, sex determining region Y antibody, sex determining region of Chr Y antibody, SRY antibody, Sry antibody

Background: This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome), translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.

Synonyms: Sex-determining region Y protein, Testis-determining factor, SRY, TDF

Gene ID: 6736

UniProt: Q05066