MDH2 antibody

Catalog No. ABIN629663

The Rabbit Polyclonal anti-MDH2 antibody is suitable to detect MDH2 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for MDH2 antibody (ABIN629663)

Target: MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MDH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MDH2 Antibody

Purification: Purified

Immunogen: MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MDH2 Blocking Peptide, (ABIN5614712), is also available for use as a blocking control in assays to test for specificity of this MDH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MDH2

Target: MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))

Alternative Name: MDH2

Background: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle.

Molecular Weight: 33 kDa (MW of target protein)