FDFT1 antibody (N-Term)

Catalog No. ABIN629705

The Rabbit Polyclonal anti-FDFT1 antibody is suitable to detect FDFT1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for FDFT1 antibody (N-Term) (ABIN629705)

Target: FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FDFT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FDFT1 Antibody

Binding Specificity: N-Term

Specificity: FDFT1 antibody was raised against the N terminal of FDFT1

Purification: Purified

Immunogen: FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FDFT1 Blocking Peptide, (ABIN939238), is also available for use as a blocking control in assays to test for specificity of this FDFT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDFT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FDFT1

Target: FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))

Alternative Name: FDFT1

Background: FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha