RSU1 antibody (C-Term)

Catalog No. ABIN629715

Product Details anti-RSU1 Antibody

Target: RSU1 (Ras Suppressor Protein 1 (RSU1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSU1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RSU1 antibody was raised against the C terminal of RSU1

Purification: Purified

Immunogen: RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSU1 Blocking Peptide, catalog no. 33R-7149, is also available for use as a blocking control in assays to test for specificity of this RSU1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSU1

Target: RSU1 (Ras Suppressor Protein 1 (RSU1))

Alternative Name: RSU1 (RSU1 Products)

Synonyms: etID12695 antibody, si:dz63m2.1 antibody, RSP-1 antibody, RsuI antibody, rsp-1 antibody, Ras suppressor protein 1 antibody, Ras suppressor protein 1 S homeolog antibody, rsu1 antibody, rsu1.S antibody, RSU1 antibody, Rsu1 antibody

Background: RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.

Molecular Weight: 31 kDa (MW of target protein)