F-Box and Leucine-Rich Repeat Protein 5 (FBXL5) antibody

Antigen: F-Box and Leucine-Rich Repeat Protein 5 (FBXL5)

Synonyms: FBL4, FBL5, FLR1, Fbl4, Fir4, wu:fb52d06, fbxl5, MGC53238, MGC81139, FBXL5, MGC148944, DKFZp459A167

Clonality: Polyclonal

Host: Rabbit

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Catalog no.: ABIN629723

Additional Information

Alternative name: FBXL5

Immunogen: FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES

Description: FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL5 belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.

Molecular Weight: 76 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FBXL5 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Proteolysis / Ubiquitin

Restrictions: For Research Use only