F-Box and Leucine-Rich Repeat Protein 7 (FBXL7) antibody

Antigen: F-Box and Leucine-Rich Repeat Protein 7 (FBXL7)

Synonyms: FBL6, FBL7, Fbl6, AL023057, MGC102204, D230018M15Rik, FBXL7

Clonality: Polyclonal

Host: Rabbit

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Catalog no.: ABIN629737

Additional Information

Alternative name: FBXL7

Immunogen: FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD

Description: FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molecular Weight: 54 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FBXL7 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Restrictions: For Research Use only