TPM2 antibody

Catalog No. ABIN629837

The Rabbit Polyclonal anti-TPM2 antibody is suitable to detect TPM2 in samples from Human and Mouse. It has been validated for WB and IHC.

Quick Overview for TPM2 antibody (ABIN629837)

Target: TPM2 (Tropomyosin-2 (TPM2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPM2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TPM2 Antibody

Purification: Purified

Immunogen: Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tropomyosin 2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPM2

Target: TPM2 (Tropomyosin-2 (TPM2))

Alternative Name: Tropomyosin 2

Background: The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.

Molecular Weight: 33 kDa (MW of target protein)