CSDC2 antibody (N-Term)

Catalog No. ABIN629884

Product Details anti-CSDC2 Antibody

Target: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSDC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CSDC2 antibody was raised against the N terminal of CSDC2

Purification: Purified

Immunogen: CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP

Application Details

Application Notes: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSDC2 Blocking Peptide, catalog no. 33R-6562, is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSDC2

Target: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Alternative Name: CSDC2 (CSDC2 Products)

Synonyms: pippin antibody, csdc2 antibody, zgc:91826 antibody, PIPPIN antibody, dJ347H13.2 antibody, AI415250 antibody, AI481750 antibody, Pippin antibody, cold shock domain containing C2, RNA binding antibody, cold shock domain containing C2 antibody, cold shock domain containing C2, RNA binding a antibody, cold shock domain containing C2 L homeolog antibody, CSDC2 antibody, csdc2 antibody, csdc2a antibody, csdc2.L antibody, Csdc2 antibody

Background: CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Molecular Weight: 17 kDa (MW of target protein)