CSDC2 antibody (Cold Shock Domain Containing C2, RNA Binding) (N-Term)

Details for Product anti-CSDC2 Antibody No. ABIN629884, Supplier: Log in to see
Antigen
  • pippin
  • csdc2
  • zgc:91826
  • PIPPIN
  • dJ347H13.2
  • AI415250
  • AI481750
  • Pippin
  • cold shock domain containing C2, RNA binding
  • cold shock domain containing C2
  • cold shock domain containing C2, RNA binding a
  • cold shock domain containing C2 L homeolog
  • CSDC2
  • csdc2
  • csdc2a
  • csdc2.L
  • Csdc2
Epitope
N-Term
10
10
9
8
7
3
2
2
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
55
19
19
3
3
3
3
3
2
1
1
1
1
1
Host
Rabbit
43
12
Clonality
Polyclonal
Conjugate
This CSDC2 antibody is un-conjugated
4
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
40
26
26
14
13
6
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP
Specificity CSDC2 antibody was raised against the N terminal of CSDC2
Purification Purified
Alternative Name CSDC2 (CSDC2 Antibody Abstract)
Background CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.
Molecular Weight 17 kDa (MW of target protein)
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CSDC2 Blocking Peptide, catalog no. 33R-6562, is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSDC2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Immunohistochemistry (IHC) image for anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody (ABIN629884) CSDC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Western Blotting (WB) image for anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody (ABIN629884) CSDC2 antibody used at 0.625 ug/ml to detect target protein.
Did you look for something else?