DDX31 antibody

Catalog No. ABIN629959

This Rabbit Polyclonal antibody specifically detects DDX31 in WB. It exhibits reactivity toward Human.

Quick Overview for DDX31 antibody (ABIN629959)

Target: DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX31 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDX31 Antibody

Purification: Purified

Immunogen: DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX31 Blocking Peptide, (ABIN5613159), is also available for use as a blocking control in assays to test for specificity of this DDX31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX31

Target: DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))

Alternative Name: DDX31

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX31 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants.

Molecular Weight: 64 kDa (MW of target protein)