CATSPER2 antibody (N-Term)

Catalog No. ABIN630061

Product Details anti-CATSPER2 Antibody

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CATSPER2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CATSPER2 antibody was raised against the N terminal of CATSPER2

Purification: Purified

Immunogen: CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CATSPER2 Blocking Peptide, catalog no. 33R-3784, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CATSPER2

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Alternative Name: CATSPER2 (CATSPER2 Products)

Synonyms: CATSPER2 antibody, cation channel, sperm associated 2 antibody, cation channel sperm associated 2 antibody, CATSPER2 antibody, Catsper2 antibody

Background: Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

Molecular Weight: 46 kDa (MW of target protein)