CACNG4 antibody (N-Term)

Catalog No. ABIN630108

Product Details anti-CACNG4 Antibody

Target: CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNG4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNG4 antibody was raised against the N terminal of CACNG4

Purification: Purified

Immunogen: CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

Application Details

Application Notes: WB: 0.31 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNG4 Blocking Peptide, catalog no. 33R-3480, is also available for use as a blocking control in assays to test for specificity of this CACNG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNG4

Target: CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))

Alternative Name: CACNG4 (CACNG4 Products)

Synonyms: CACNG4 antibody, AI413107 antibody, AW491861 antibody, calcium voltage-gated channel auxiliary subunit gamma 4 antibody, calcium channel, voltage-dependent, gamma subunit 4 antibody, CACNG4 antibody, Cacng4 antibody

Background: L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits.

Molecular Weight: 36 kDa (MW of target protein)