Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

OAT antibody

Antigen

OAT

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630132
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
Description OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.
Molecular Weight 45 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of OAT antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "OAT", type "Antibodies"
Hosts Mouse (4), Rabbit (4)
Reactivities Human (10), Mouse (Murine) (3), Rat (Rattus) (1)
Applications Western Blotting (WB) (10), ELISA (7), Immunofluorescence (IF) (6), Enzyme Immunoassay (EIA) (2), Immunohistochemistry (IHC) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)