OAT antibody

Catalog No. ABIN630132

The Rabbit Polyclonal anti-OAT antibody (ABIN630132) specifically detects OAT in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for OAT antibody (ABIN630132)

Target: OAT (Ornithine Aminotransferase (OAT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OAT Antibody

Purification: Purified

Immunogen: OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OAT Blocking Peptide, (ABIN5615101), is also available for use as a blocking control in assays to test for specificity of this OAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OAT

Target: OAT (Ornithine Aminotransferase (OAT))

Background: OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.

Molecular Weight: 45 kDa (MW of target protein)