Follistatin antibody (C-Term)
-
- Target See all Follistatin (FST) Antibodies
- Follistatin (FST)
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Follistatin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FST antibody was raised against the C terminal of FST
- Purification
- Purified
- Immunogen
- FST antibody was raised using the C terminal of FST corresponding to a region with amino acids SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
- Top Product
- Discover our top product FST Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FST Blocking Peptide, catalog no. 33R-8580, is also available for use as a blocking control in assays to test for specificity of this FST antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FST antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Follistatin (FST)
- Alternative Name
- FST (FST Products)
- Synonyms
- CG12955 antibody, CG12956 antibody, CG33466 antibody, Dmel\\CG33466 antibody, Fol1 antibody, dFS antibody, dFol1 antibody, dfs antibody, fs antibody, FS antibody, foll antibody, xfs antibody, FST antibody, fst antibody, AL033346 antibody, FOL1 antibody, Fst-288 antibody, RATFOL1 antibody, cb446 antibody, fd07h10 antibody, fst1 antibody, wu:fd07h10 antibody, Follistatin antibody, follistatin antibody, follistatin L homeolog antibody, follistatin a antibody, Fs antibody, fst antibody, FST antibody, LOC100141662 antibody, fst.L antibody, Fst antibody, fsta antibody
- Background
- Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-