PIK3R3 antibody

Catalog No. ABIN630213

Product Details anti-PIK3R3 Antibody

Target: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIK3R3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PIK3 R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIK3R3 Blocking Peptide, catalog no. 33R-2832, is also available for use as a blocking control in assays to test for specificity of this PIK3R3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIK3R3

Target: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Alternative Name: PIK3R3 (PIK3R3 Products)

Synonyms: AA414954 antibody, p55pik antibody, p55 antibody, p55-GAMMA antibody, pik3r3 antibody, zgc:55564 antibody, zgc:85710 antibody, phosphoinositide-3-kinase regulatory subunit 3 antibody, phosphoinositide-3-kinase, regulatory subunit 3 (gamma) antibody, phosphoinositide-3-kinase, regulatory subunit 3b (gamma) antibody, PIK3R3 antibody, Pik3r3 antibody, pik3r3b antibody

Background: PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.

Molecular Weight: 54 kDa (MW of target protein)