RARRES3 antibody

Catalog No. ABIN630298

This Rabbit Polyclonal antibody specifically detects RARRES3 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for RARRES3 antibody (ABIN630298)

Target: RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RARRES3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RARRES3 Antibody

Purification: Purified

Immunogen: RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RARRES3 Blocking Peptide, (ABIN938468), is also available for use as a blocking control in assays to test for specificity of this RARRES3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARRES3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RARRES3

Target: RARRES3 (Retinoic Acid Receptor Responder (Tazarotene Induced) 3 (RARRES3))

Alternative Name: RARRES3

Background: Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.

Molecular Weight: 18 kDa (MW of target protein)