ZP2 antibody

Catalog No. ABIN630305

Product Details anti-ZP2 Antibody

Target: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: ZP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZP2 Blocking Peptide, catalog no. 33R-7023, is also available for use as a blocking control in assays to test for specificity of this ZP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZP2

Target: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Alternative Name: ZP2 (ZP2 Products)

Synonyms: fa12e07 antibody, wu:fa12e07 antibody, zgc:152728 antibody, zp2 antibody, Zp-2 antibody, ZPA antibody, zona pellucida glycoprotein 2, tandem duplicate 5 antibody, zona pellucida glycoprotein 2 antibody, zp2.5 antibody, Zp2 antibody, ZP2 antibody

Background: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. ZP2 is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.

Molecular Weight: 68 kDa (MW of target protein)